Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | CD71/Transferrin Receptor Rabbit mAb |
---|---|
Catalog No. | A22161 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54396 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2). |
---|---|
Sequence | RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV |
Gene ID | 7037 |
Swiss prot | P02786 |
Synonyms | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 |
Calculated MW | 85kDa |
Observed MW | 90kDa |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa |
Cellular location | basolateral plasma membrane, blood microparticle, cell surface, clathrin-coated pit, cytoplasmic vesicle, early endosome, endosome, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, melanosome, mitochondrion, nucleus, perinuclear region of cytoplasm, plasma membrane, recycling endosome |
Customer validation | WB (Homo sapiens, Mus musculus) IF (Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A22161 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TFRC. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TFRC. (Distance between topics and target gene indicate popularity.) TFRC
* Data provided by citexs.com, for reference only.
Publishing research using A22161? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.