Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD71/Transferrin Receptor Rabbit mAb (A22161)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CD71/Transferrin Receptor Rabbit mAb (A22161)

Western blot analysis of lysates from HeLa cells, using CD71/Transferrin Receptor Rabbit mAb (A22161) at1:80000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - CD71/Transferrin Receptor Rabbit mAb (A22161)

Immunohistochemistry analysis of CD71/Transferrin Receptor in paraffin-embedded human lung using CD71/Transferrin Receptor Rabbit mAb (A22161) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CD71/Transferrin Receptor Rabbit mAb (A22161)

Confocal imaging of HeLa cells using CD71/Transferrin Receptor Rabbit mAb (A22161, dilution 1:200) (Red). The cells were counterstained with CD44 Rabbit mAb (A21919, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

You may also interested in:

Overview

Product name CD71/Transferrin Receptor Rabbit mAb
Catalog No. A22161
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC54396

Background

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2).
Sequence RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID 7037
Swiss prot P02786
Synonyms T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Calculated MW 85kDa
Observed MW 90kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:10000 - 1:90000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location basolateral plasma membrane, blood microparticle, cell surface, clathrin-coated pit, cytoplasmic vesicle, early endosome, endosome, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, melanosome, mitochondrion, nucleus, perinuclear region of cytoplasm, plasma membrane, recycling endosome
Customer validation

WB (Homo sapiens, Mus musculus)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD71/Transferrin Receptor Rabbit mAb images

ABclonal:Western blot - CD71/Transferrin Receptor Rabbit mAb (A22161)}

Western blot - CD71/Transferrin Receptor Rabbit mAb (A22161)

Western blot analysis of lysates from HeLa cells, using CD71/Transferrin Receptor Rabbit mAb (A22161) at1:80000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - CD71/Transferrin Receptor Rabbit mAb (A22161)}

Immunohistochemistry - CD71/Transferrin Receptor Rabbit mAb (A22161)

Immunohistochemistry analysis of CD71/Transferrin Receptor in paraffin-embedded human lung using CD71/Transferrin Receptor Rabbit mAb (A22161) at dilution of 1:200(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - CD71/Transferrin Receptor Rabbit mAb (A22161)}

Immunofluorescence - CD71/Transferrin Receptor Rabbit mAb (A22161)

Confocal imaging of HeLa cells using CD71/Transferrin Receptor Rabbit mAb (A22161, dilution 1:200) (Red). The cells were counterstained with CD44 Rabbit mAb (A21919, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Inquire About This Product

Submit your question about A22161 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TFRC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TFRC. (Distance between topics and target gene indicate popularity.) TFRC

* Data provided by citexs.com, for reference only.

Publishing research using A22161? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order