Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD45 Rabbit mAb (A19021)

PathoQIHC Pathology

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CD45 Rabbit mAb (A19021)

Western blot analysis of Jurkat, using CD45 Rabbit mAb (A19021) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CD45 Rabbit mAb (A19021)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD45 Rabbit mAb (A19021) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD45 Rabbit mAb
Catalog No. A19021
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0459

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3).
Sequence SDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFG
Gene ID 5788
Swiss prot P08575
Synonyms LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105
Calculated MW 147kDa
Observed MW 180-240kDa

Applications

Reactivity Human
Tested applications Testing results
IHC-P Human
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat cells
Cellular location Membrane, Membrane raft, Single-pass type I membrane protein
Customer validation

IF (Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD45 Rabbit mAb images

ABclonal:Western blot - CD45 Rabbit mAb (A19021)}

Western blot - CD45 Rabbit mAb (A19021)

Western blot analysis of Jurkat, using CD45 Rabbit mAb (A19021) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - CD45 Rabbit mAb (A19021)}

Immunohistochemistry - CD45 Rabbit mAb (A19021)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD45 Rabbit mAb (A19021) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19021 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PTPRC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PTPRC. (Distance between topics and target gene indicate popularity.) PTPRC

* Data provided by citexs.com, for reference only.

Publishing research using A19021? Please let us know so that we can cite the reference in this datasheet.

Antibodies (17)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order