Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD44 Rabbit pAb (A1351)

Review (1) Publications (11) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD44 Rabbit pAb (A1351)

Western blot analysis of extracts of various cell lines, using CD44 antibody (A1351) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - CD44 Rabbit pAb (A1351)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD44 antibody (A1351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD44 Rabbit pAb (A1351)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD44 antibody (A1351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for CD44 Rabbit pAb(A1351)

You may also interested in:

Overview

Product name CD44 Rabbit pAb
Catalog No. A1351
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of CD44 (NP_000601.3).
Sequence AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
Gene ID 960
Swiss prot P16070
Synonyms IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1; CD44
Calculated MW 82kDa
Observed MW 82kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples MCF7, HeLa, Raji, A-549, U-251MG, Mouse liver, Mouse spleen
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB (unknow, Homo sapiens, Mus musculus, Gallus gallus)

IF (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD44 Rabbit pAb images

ABclonal:Western blot - CD44 Rabbit pAb (A1351)}

Western blot - CD44 Rabbit pAb (A1351)

Western blot analysis of extracts of various cell lines, using CD44 antibody (A1351) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunohistochemistry - CD44 Rabbit pAb (A1351)}

Immunohistochemistry - CD44 Rabbit pAb (A1351)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD44 antibody (A1351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD44 Rabbit pAb (A1351)}

Immunohistochemistry - CD44 Rabbit pAb (A1351)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD44 antibody (A1351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A1351

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1351 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD44. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD44. (Distance between topics and target gene indicate popularity.) CD44

* Data provided by citexs.com, for reference only.

Publishing research using A1351? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order