Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD3E Rabbit mAb (A19017)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD3E Rabbit mAb (A19017)

Western blot analysis of various lysates, using CD3E Rabbit pAb (A19017) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded mouse spleen tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human small intestine tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded rat spleen tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human colon carcinoma tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name CD3E Rabbit mAb
Catalog No. A19017
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51750

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD3E (NP_000724.1).
Sequence PQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYY
Gene ID 916
Swiss prot P07766
Synonyms T3E; TCRE; IMD18; CD3epsilon; CD3E
Calculated MW 23kDa
Observed MW 23kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

IF (Homo sapiens)

IHC (Homo sapiens, Mus musculus)

FC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD3E Rabbit mAb images

ABclonal:Western blot - CD3E Rabbit mAb (A19017)}

Western blot - CD3E Rabbit mAb (A19017)

Western blot analysis of various lysates, using CD3E Rabbit pAb (A19017) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)}

Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded mouse spleen tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)}

Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human small intestine tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)}

Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded rat spleen tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)}

Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human colon carcinoma tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - CD3E Rabbit mAb (A19017)}

Immunohistochemistry - CD3E Rabbit mAb (A19017)

Immunohistochemistry analysis of CD3E in paraffin-embedded human tonsil tissue using CD3E Rabbit mAb (A19017) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A19017 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD3E. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD3E. (Distance between topics and target gene indicate popularity.) CD3E

* Data provided by citexs.com, for reference only.

Publishing research using A19017? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order