Publications (14) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | CD36/SR-B3 Rabbit pAb |
---|---|
Catalog No. | A5792 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-439 of human CD36/SR-B3 (NP_000063.2). |
---|---|
Sequence | GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN |
Gene ID | 948 |
Swiss prot | P16671 |
Synonyms | FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; CD36/SR-B3 |
Calculated MW | 53kDa |
Observed MW | 70-110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | Mouse heart, Rat heart |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB (Mus musculus, Rattus norvegicus, Gallus gallus) IF (Mus musculus) IF (Mus musculus) sCD36 level was measured (Homo sapiens) |
Submit your question about A5792 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD36. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD36. (Distance between topics and target gene indicate popularity.) CD36
* Data provided by citexs.com, for reference only.
Publishing research using A5792? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.