Review (1)Publications (3) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human
Product name | CD36/SR-B3 Rabbit pAb |
---|---|
Catalog No. | A1470 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36/SR-B3 (NP_001120916.1). |
---|---|
Sequence | ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ |
Gene ID | 948 |
Swiss prot | P16671 |
Synonyms | BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3; CD36 |
Calculated MW | 32kDa/46kDa/48kDa/53kDa |
Observed MW | 70-110kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa, 293T, Mouse heart, Rat heart |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | (rat liver) WB(Homo sapiens, Mus musculus, Rattus norvegicus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1470 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1470? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.