Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD36/SR-B3 Rabbit pAb (A1470)

Review (1) Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD36/SR-B3 Rabbit pAb (A1470)

Western blot analysis of lysates from U-937 cells using CD36/SR-B3 Rabbit pAb(A1470) at 1:700 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.

Review
ABclonal: review for CD36/SR-B3 Rabbit pAb(A1470)

You may also interested in:

Overview

Product name CD36/SR-B3 Rabbit pAb
Catalog No. A1470
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36/SR-B3 (NP_001120916.1).
Sequence ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
Gene ID 948
Swiss prot P16671
Synonyms FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; CD36/SR-B3
Calculated MW 53kDa
Observed MW 70-110kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-937
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

WB (rat liverHomo sapiens, Mus musculus, Rattus norvegicus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD36/SR-B3 Rabbit pAb images

ABclonal:Western blot - CD36/SR-B3 Rabbit pAb (A1470)}

Western blot - CD36/SR-B3 Rabbit pAb (A1470)

Western blot analysis of lysates from U-937 cells using CD36/SR-B3 Rabbit pAb(A1470) at 1:700 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.

Submit an review for A1470

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1470 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD36. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD36. (Distance between topics and target gene indicate popularity.) CD36

* Data provided by citexs.com, for reference only.

Publishing research using A1470? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order