Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD36/SR-B3 Rabbit mAb (A19016)

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - CD36/SR-B3 Rabbit mAb (A19016)

Western blot analysis of extracts of various cell lines, using CD36/SR-B3 antibody (A19016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

You may also interested in:

Overview

Product name CD36/SR-B3 Rabbit mAb
Catalog No. A19016
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0461

Background

The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD36/SR-B3 (P16671).
Sequence FASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
Gene ID 948
Swiss prot P16671
Synonyms FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; CD36/SR-B3
Calculated MW 53kDa
Observed MW 80kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart, Rat heart
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus)

IHC (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD36/SR-B3 Rabbit mAb images

ABclonal:Western blot - CD36/SR-B3 Rabbit mAb (A19016)}

Western blot - CD36/SR-B3 Rabbit mAb (A19016)

Western blot analysis of extracts of various cell lines, using CD36/SR-B3 antibody (A19016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Inquire About This Product

Submit your question about A19016 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD36. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD36. (Distance between topics and target gene indicate popularity.) CD36

* Data provided by citexs.com, for reference only.

Publishing research using A19016? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order