Publications (9) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Mouse, Rat
Product name | CD36/SR-B3 Rabbit mAb |
---|---|
Catalog No. | A19016 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0461 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD36/SR-B3 (P16671). |
---|---|
Sequence | FASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ |
Gene ID | 948 |
Swiss prot | P16671 |
Synonyms | FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10; CD36/SR-B3 |
Calculated MW | 53kDa |
Observed MW | 80kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Mouse heart, Rat heart |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB (Mus musculus) IHC (Mus musculus) IF (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19016 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CD36. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CD36. (Distance between topics and target gene indicate popularity.) CD36
* Data provided by citexs.com, for reference only.
Publishing research using A19016? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.