Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD31/PECAM1 Rabbit pAb (A2104)

Publications (12) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CD31/PECAM1 Rabbit pAb (A2104)

Western blot analysis of extracts of Jurkat cells, using CD31/PECAM1 antibody (A2104) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - CD31/PECAM1 Rabbit pAb (A2104)

Immunofluorescence analysis of human placenta using CD31/PECAM1 Rabbit pAb (A2104) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CD31/PECAM1 Rabbit pAb
Catalog No. A2104
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID 5175
Swiss prot P16284
Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW 83kDa
Observed MW 130kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Jurkat
Cellular location Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein
Customer validation

IHC (Homo sapiens, Mus musculus, Rattus norvegicus, Oryctolagus cuniculus)

IF (Rattus norvegicus, Mus musculus, Homo sapiens)

WB (Rattus norvegicus, Homo sapiens)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD31/PECAM1 Rabbit pAb images

ABclonal:Western blot - CD31/PECAM1 Rabbit pAb (A2104)}

Western blot - CD31/PECAM1 Rabbit pAb (A2104)

Western blot analysis of extracts of Jurkat cells, using CD31/PECAM1 antibody (A2104) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - CD31/PECAM1 Rabbit pAb (A2104)}

Immunofluorescence - CD31/PECAM1 Rabbit pAb (A2104)

Immunofluorescence analysis of human placenta using CD31/PECAM1 Rabbit pAb (A2104) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A2104 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PECAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PECAM1. (Distance between topics and target gene indicate popularity.) PECAM1

* Data provided by citexs.com, for reference only.

Publishing research using A2104? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order