Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD31/PECAM1 Rabbit mAb (A4900)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD31/PECAM1 Rabbit mAb (A4900)

Western blot analysis of various lysates, using CD31/PECAM1 Rabbit mAb (A4900) at 1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human placenta using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human tonsil using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CD31/PECAM1 Rabbit mAb (A4900)

Immunofluorescence analysis of paraffin-embedded Human placentla using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CD31/PECAM1 Rabbit mAb
Catalog No. A4900
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC50355

Background

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID 5175
Swiss prot P16284
Synonyms CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW 83kDa
Observed MW 130-140kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IF/ICC Human
IHC-P Human
WB HumanMouse
Recommended dilution
  • WB 1:10000 - 1:70000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-937, Mouse heart
Cellular location Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein
Customer validation

IF (Mus musculus, Sus scrofa, Rattus norvegicus, Homo sapiens)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD31/PECAM1 Rabbit mAb images

ABclonal:Western blot - CD31/PECAM1 Rabbit mAb (A4900)}

Western blot - CD31/PECAM1 Rabbit mAb (A4900)

Western blot analysis of various lysates, using CD31/PECAM1 Rabbit mAb (A4900) at 1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)}

Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human placenta using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)}

Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A4900)

Immunohistochemistry analysis of CD31/PECAM1 in paraffin-embedded human tonsil using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - CD31/PECAM1 Rabbit mAb (A4900)}

Immunofluorescence - CD31/PECAM1 Rabbit mAb (A4900)

Immunofluorescence analysis of paraffin-embedded Human placentla using CD31/PECAM1 Rabbit mAb (A4900) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4900 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PECAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PECAM1. (Distance between topics and target gene indicate popularity.) PECAM1

* Data provided by citexs.com, for reference only.

Publishing research using A4900? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order