Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD26/DPP4 Rabbit mAb (A4252)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD26/DPP4 Rabbit mAb (A4252)

Western blot analysis of extracts of various cell lines, using CD26/DPP4 Rabbit mAb (A4252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

You may also interested in:

Overview

Product name CD26/DPP4 Rabbit mAb
Catalog No. A4252
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0939

Background

The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).
Sequence TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Gene ID 1803
Swiss prot P27487
Synonyms CD26; ADABP; ADCP2; DPPIV; TP103; CD26/DPP4
Calculated MW 88kDa
Observed MW 105kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Rat lung, Rat liver, Rat kidney
Cellular location Apical cell membrane, Cell junction, Cell membrane, Cell projection, Membrane raft, Secreted, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD26/DPP4 Rabbit mAb images

ABclonal:Western blot - CD26/DPP4 Rabbit mAb (A4252)}

Western blot - CD26/DPP4 Rabbit mAb (A4252)

Western blot analysis of extracts of various cell lines, using CD26/DPP4 Rabbit mAb (A4252) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Inquire About This Product

Submit your question about A4252 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DPP4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DPP4. (Distance between topics and target gene indicate popularity.) DPP4

* Data provided by citexs.com, for reference only.

Publishing research using A4252? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order