Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CD11b/ITGAM Rabbit mAb (A19010)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunohistochemistry - CD11b/ITGAM Rabbit mAb (A19010)

Immunohistochemistry analysis of CD11b/ITGAM in paraffin-embedded human lung cancer using CD11b/ITGAM Rabbit mAb (A19010) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD11b/ITGAM Rabbit mAb
Catalog No. A19010
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0414

Background

This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1053-1152 of human CD11b/ITGAM (P11215).
Sequence FDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ
Gene ID 3684
Swiss prot P11215
Synonyms CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; CD11b/ITGAM
Calculated MW 127kDa
Observed MW

Applications

Reactivity Human
Tested applications Testing results
IHC-P Human
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • FC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Flow Cytometry    
Positive samples
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Rattus norvegicus, Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD11b/ITGAM Rabbit mAb images

ABclonal:Immunohistochemistry - CD11b/ITGAM Rabbit mAb (A19010)}

Immunohistochemistry - CD11b/ITGAM Rabbit mAb (A19010)

Immunohistochemistry analysis of CD11b/ITGAM in paraffin-embedded human lung cancer using CD11b/ITGAM Rabbit mAb (A19010) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19010 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ITGAM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ITGAM. (Distance between topics and target gene indicate popularity.) ITGAM

* Data provided by citexs.com, for reference only.

Publishing research using A19010? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order