Publications (3) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | CD11b/ITGAM Rabbit mAb |
---|---|
Catalog No. | A19010 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0414 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1053-1152 of human CD11b/ITGAM (P11215). |
---|---|
Sequence | FDWYIKTSHNHLLIVSTAEILFNDSVFTLLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ |
Gene ID | 3684 |
Swiss prot | P11215 |
Synonyms | CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; CD11b/ITGAM |
Calculated MW | 127kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | Testing results |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Flow Cytometry |
Positive samples | |
Cellular location | Membrane, Single-pass type I membrane protein |
Customer validation | WB (Rattus norvegicus, Mus musculus) IHC (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A19010 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ITGAM. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ITGAM. (Distance between topics and target gene indicate popularity.) ITGAM
* Data provided by citexs.com, for reference only.
Publishing research using A19010? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.