Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | CD10/MME Rabbit pAb |
---|---|
Catalog No. | A5664 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human CD10/MME (NP_000893.2). |
---|---|
Sequence | DQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITN |
Gene ID | 4311 |
Swiss prot | P08473 |
Synonyms | CALLA; CD10; CMT2T; NEP; SCA43; SFE; MME |
Calculated MW | 85kDa |
Observed MW | 100KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | 293T, Mouse lung, Mouse kidney, Rat kidney |
Cellular location | Cell membrane, Single-pass type II membrane protein |
Customer validation | WB(Mus musculus, Homo sapiens) IHC(Mus musculus) |
Submit your question about A5664 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A5664? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.