Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CCL3 Rabbit pAb (A7568)

Reviews (2) Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CCL3 Rabbit pAb (A7568)

Western blot analysis of lysates from THP-1 cells, using CCL3 Rabbit pAb (A7568) at 1:1000 dilution.THP-1 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Review
ABclonal: review for CCL3 Rabbit pAb(A7568)
Review
ABclonal: review for CCL3 Rabbit pAb(A7568)

You may also interested in:

Overview

Product name CCL3 Rabbit pAb
Catalog No. A7568
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 24-92 of human CCL3 (NP_002974.1).
Sequence SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Gene ID 6348
Swiss prot P10147
Synonyms MIP1A; SCYA3; G0S19-1; LD78ALPHA; MIP-1-alpha; CCL3
Calculated MW 10kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples THP-1
Cellular location Secreted
Customer validation

IHC (Human breast cancerRattus norvegicus, Homo sapiens, Mus musculus)

WB (Human breast cancerRattus norvegicus, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CCL3 Rabbit pAb images

ABclonal:Western blot - CCL3 Rabbit pAb (A7568)}

Western blot - CCL3 Rabbit pAb (A7568)

Western blot analysis of lysates from THP-1 cells, using CCL3 Rabbit pAb (A7568) at 1:1000 dilution.THP-1 cells were treated by LPS for 6 hours and Brefeldin A for 3 hours of stimulation.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Submit an review for A7568

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7568 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCL3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCL3. (Distance between topics and target gene indicate popularity.) CCL3

* Data provided by citexs.com, for reference only.

Publishing research using A7568? Please let us know so that we can cite the reference in this datasheet.

Proteins (2)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order