Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CCDC47 Rabbit pAb (A15871)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CCDC47 Rabbit pAb (A15871)

Western blot analysis of various lysates using CCDC47 Rabbit pAb (A15871) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of C6 cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of L929 cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of U-2 OS cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CCDC47 Rabbit pAb
Catalog No. A15871
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables protein folding chaperone and ribosome binding activity. Involved in ERAD pathway; endoplasmic reticulum calcium ion homeostasis; and protein insertion into ER membrane. Located in endoplasmic reticulum. Is integral component of endoplasmic reticulum membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 224-483 of human CCDC47 (NP_064583.2).
Sequence FLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM
Gene ID 57003
Swiss prot Q96A33
Synonyms THNS; GK001; MSTP041; CCDC47
Calculated MW 56kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples LO2, OVCAR3, Mouse lung
Cellular location Membrane, Single-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CCDC47 Rabbit pAb images

ABclonal:Western blot - CCDC47 Rabbit pAb (A15871)}

Western blot - CCDC47 Rabbit pAb (A15871)

Western blot analysis of various lysates using CCDC47 Rabbit pAb (A15871) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)}

Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of C6 cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)}

Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of L929 cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - CCDC47 Rabbit pAb (A15871)}

Immunofluorescence - CCDC47 Rabbit pAb (A15871)

Immunofluorescence analysis of U-2 OS cells using CCDC47 Rabbit pAb (A15871) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15871 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCDC47. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCDC47. (Distance between topics and target gene indicate popularity.) CCDC47

* Data provided by citexs.com, for reference only.

Publishing research using A15871? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order