Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CAMSAP1 Rabbit pAb (A17839)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CAMSAP1 Rabbit pAb (A17839)

Western blot analysis of lysates from HeLa cells, using CAMSAP1 Rabbit pAb (A17839) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CAMSAP1 Rabbit pAb (A17839)

Immunofluorescence analysis of L929 cells using CAMSAP1 Rabbit pAb (A17839) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CAMSAP1 Rabbit pAb
Catalog No. A17839
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables microtubule minus-end binding activity and spectrin binding activity. Involved in several processes, including neuron projection development; regulation of cell morphogenesis; and regulation of microtubule polymerization. Located in microtubule. Colocalizes with microtubule minus-end.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-650 of human CAMSAP1 (NP_056262.3).
Sequence KTVLHQKSSRPPVPISNATKRSFLGSPAAGTLAELQPPVQLPAEGCHRHYLHPEEPEYLGKGTAAFSPSHPLLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHAASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTATKSHGKSLLSNVSIEDEEEELVAIVRADVVPQQADPEFPRASPRALGLTANARSPQGQLDTSESKPDSFFLEPLMPAVLKPAKEKQVITKEDERGEGRPRSIVSRRPSEGPQPLVRRKMTGSRDLNRTF
Gene ID 157922
Swiss prot Q5T5Y3
Synonyms CDCBM12; CAMSAP1
Calculated MW 178kDa
Observed MW 240kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa
Cellular location cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CAMSAP1 Rabbit pAb images

ABclonal:Western blot - CAMSAP1 Rabbit pAb (A17839)}

Western blot - CAMSAP1 Rabbit pAb (A17839)

Western blot analysis of lysates from HeLa cells, using CAMSAP1 Rabbit pAb (A17839) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - CAMSAP1 Rabbit pAb (A17839)}

Immunofluorescence - CAMSAP1 Rabbit pAb (A17839)

Immunofluorescence analysis of L929 cells using CAMSAP1 Rabbit pAb (A17839) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17839 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CAMSAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CAMSAP1. (Distance between topics and target gene indicate popularity.) CAMSAP1

* Data provided by citexs.com, for reference only.

Publishing research using A17839? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order