Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

C9orf114 Rabbit pAb (A18460)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - C9orf114 Rabbit pAb (A18460)

Western blot analysis of various lysates using C9orf114 Rabbit pAb (A18460) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - C9orf114 Rabbit pAb (A18460)

Immunohistochemistry analysis of C9orf114 in paraffin-embedded Human liver cancer using C9orf114 Rabbit pAb (A18460) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - C9orf114 Rabbit pAb (A18460)

Immunohistochemistry analysis of C9orf114 in paraffin-embedded Rat kidney using C9orf114 Rabbit pAb (A18460) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name C9orf114 Rabbit pAb
Catalog No. A18460
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables miRNA binding activity. Involved in maintenance of centrosome location and production of miRNAs involved in gene silencing by miRNA. Located in kinetochore; mitotic spindle; and spindle pole centrosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 163-340 of human C9orf114 (NP_057474.2).
Sequence HQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYV
Gene ID 51490
Swiss prot Q5T280
Synonyms CENP32; CENP-32; HSPC109; C9orf114
Calculated MW 42kDa
Observed MW 42kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-87MG, K-562
Cellular location cytoplasm, mitotic spindle, spindle pole centrosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

C9orf114 Rabbit pAb images

ABclonal:Western blot - C9orf114 Rabbit pAb (A18460)}

Western blot - C9orf114 Rabbit pAb (A18460)

Western blot analysis of various lysates using C9orf114 Rabbit pAb (A18460) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - C9orf114 Rabbit pAb (A18460)}

Immunohistochemistry - C9orf114 Rabbit pAb (A18460)

Immunohistochemistry analysis of C9orf114 in paraffin-embedded Human liver cancer using C9orf114 Rabbit pAb (A18460) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - C9orf114 Rabbit pAb (A18460)}

Immunohistochemistry - C9orf114 Rabbit pAb (A18460)

Immunohistochemistry analysis of C9orf114 in paraffin-embedded Rat kidney using C9orf114 Rabbit pAb (A18460) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A18460 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SPOUT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SPOUT1. (Distance between topics and target gene indicate popularity.) SPOUT1

* Data provided by citexs.com, for reference only.

Publishing research using A18460? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order