Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Bid Rabbit pAb (A0210)

Review (1) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Bid Rabbit pAb (A0210)

Western blot analysis of lysates from Jurkat cells, using Bid Rabbit pAb (A0210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Bid Rabbit pAb (A0210)

Western blot analysis of lysates from Rat thymus, using Bid Rabbit pAb (A0210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - Bid Rabbit pAb (A0210)

Immunofluorescence analysis of NIH-3T3 cells using Bid Rabbit pAb (A0210) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Bid Rabbit pAb(A0210)

You may also interested in:

Overview

Product name Bid Rabbit pAb
Catalog No. A0210
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human Bid (NP_001187.1).
Sequence MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Gene ID 637
Swiss prot P55957
Synonyms FP497; Bid
Calculated MW 22kDa
Observed MW 20kDa//15kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Jurkat, Rat thymus, Mouse liver, Mouse heart, 293T
Cellular location Cytoplasm, Mitochondrion membrane, Mitochondrion membrane
Customer validation

WB (Human fibrosarcoma cellsBos taurus, Rattus norvegicus, Mus musculus, Sus scrofa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Bid Rabbit pAb images

ABclonal:Western blot - Bid Rabbit pAb (A0210)}

Western blot - Bid Rabbit pAb (A0210)

Western blot analysis of lysates from Jurkat cells, using Bid Rabbit pAb (A0210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Bid Rabbit pAb (A0210)}

Western blot - Bid Rabbit pAb (A0210)

Western blot analysis of lysates from Rat thymus, using Bid Rabbit pAb (A0210) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunofluorescence - Bid Rabbit pAb (A0210)}

Immunofluorescence - Bid Rabbit pAb (A0210)

Immunofluorescence analysis of NIH-3T3 cells using Bid Rabbit pAb (A0210) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0210

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0210 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BID. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BID. (Distance between topics and target gene indicate popularity.) BID

* Data provided by citexs.com, for reference only.

Publishing research using A0210? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order