Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BiP/GRP78 Rabbit pAb (A11366)

Reviews (2) Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BiP/GRP78 Rabbit pAb (A11366)

Western blot analysis of extracts of various cell lines, using BiP/GRP78 antibody (A11366) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)

Immunohistochemistry analysis of paraffin-embedded mouse brain using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)

Immunohistochemistry analysis of paraffin-embedded rat brain using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of NIH/3T3 cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of PC-12 cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of U2OS cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for BiP/GRP78 Rabbit pAb(A11366)
Review
ABclonal: review for BiP/GRP78 Rabbit pAb(A11366)

You may also interested in:

Overview

Product name BiP/GRP78 Rabbit pAb
Catalog No. A11366
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. This protein localizes to the lumen of the endoplasmic reticulum (ER) where it operates as a typical HSP70 chaperone involved in the folding and assembly of proteins in the ER and is a master regulator of ER homeostasis. During cellular stress, as during viral infection or tumorogenesis, this protein interacts with the transmembrane stress sensor proteins PERK (protein kinase R-like endoplasmic reticulum kinase), IRE1 (inositol-requiring kinase 1), and ATF6 (activating transcription factor 6) where it acts as a repressor of the unfolded protein response (UPR) and also plays a role in cellular apoptosis and senescence. Elevated expression and atypical translocation of this protein to the cell surface has been reported in viral infections and some types of cancer cells. At the cell surface this protein may facilitate viral attachment and entry to host cells. This gene is a therapeutic target for the treatment of coronavirus diseases and chemoresistant cancers.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-654 of human BiP/GRP78 (NP_005338.1).
Sequence EEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
Gene ID 3309
Swiss prot P11021
Synonyms BIP; GRP78; HEL-S-89n; BiP/GRP78
Calculated MW 72kDa
Observed MW 72kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, U-87MG, Mouse liver, Rat liver, Rat testis
Cellular location Cytoplasm, Endoplasmic reticulum lumen, Melanosome
Customer validation

IF (Human renal epithelial cell line)

WB (Pheochromocytoma in miceHomo sapiens, Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BiP/GRP78 Rabbit pAb images

ABclonal:Western blot - BiP/GRP78 Rabbit pAb (A11366)}

Western blot - BiP/GRP78 Rabbit pAb (A11366)

Western blot analysis of extracts of various cell lines, using BiP/GRP78 antibody (A11366) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)}

Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)

Immunohistochemistry analysis of paraffin-embedded mouse brain using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)}

Immunohistochemistry - BiP/GRP78 Rabbit pAb (A11366)

Immunohistochemistry analysis of paraffin-embedded rat brain using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)}

Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of NIH/3T3 cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)}

Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of PC-12 cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)}

Immunofluorescence - BiP/GRP78 Rabbit pAb (A11366)

Immunofluorescence analysis of U2OS cells using BiP/GRP78 Rabbit pAb (A11366) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A11366

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11366 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HSPA5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HSPA5. (Distance between topics and target gene indicate popularity.) HSPA5

* Data provided by citexs.com, for reference only.

Publishing research using A11366? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order