Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BST2 Rabbit pAb (A1914)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - BST2 Rabbit pAb (A1914)

Western blot analysis of various lysates using BST2 Rabbit pAb (A1914) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name BST2 Rabbit pAb
Catalog No. A1914
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1).
Sequence NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
Gene ID 684
Swiss prot Q10589
Synonyms CD317; HM1.24; TETHERIN; BST2
Calculated MW 20kDa
Observed MW 36kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, 293T
Cellular location Apical cell membrane, Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Late endosome, Lipid-anchor, Membrane raft, Single-pass type II membrane protein, trans-Golgi network

Research Area

BST2 Rabbit pAb images

ABclonal:Western blot - BST2 Rabbit pAb (A1914)}

Western blot - BST2 Rabbit pAb (A1914)

Western blot analysis of various lysates using BST2 Rabbit pAb (A1914) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A1914 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BST2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BST2. (Distance between topics and target gene indicate popularity.) BST2

* Data provided by citexs.com, for reference only.

Publishing research using A1914? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order