Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BOK Rabbit pAb (A16354)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BOK Rabbit pAb (A16354)

Western blot analysis of extracts of various cell lines, using BOK antibody (A16354) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded rat lung using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded rat ovary using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - BOK Rabbit pAb (A16354)

Immunofluorescence analysis of MCF7 cells using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - BOK Rabbit pAb (A16354)

Immunofluorescence analysis of NIH/3T3 cells using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name BOK Rabbit pAb
Catalog No. A16354
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BOK (NP_115904.1).
Sequence MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP
Gene ID 666
Swiss prot Q9UMX3
Synonyms BOKL; BCL2L9; BOK
Calculated MW 23kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse brain, Rat testis
Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BOK Rabbit pAb images

ABclonal:Western blot - BOK Rabbit pAb (A16354)}

Western blot - BOK Rabbit pAb (A16354)

Western blot analysis of extracts of various cell lines, using BOK antibody (A16354) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)}

Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)}

Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded rat lung using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BOK Rabbit pAb (A16354)}

Immunohistochemistry - BOK Rabbit pAb (A16354)

Immunohistochemistry analysis of paraffin-embedded rat ovary using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - BOK Rabbit pAb (A16354)}

Immunofluorescence - BOK Rabbit pAb (A16354)

Immunofluorescence analysis of MCF7 cells using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - BOK Rabbit pAb (A16354)}

Immunofluorescence - BOK Rabbit pAb (A16354)

Immunofluorescence analysis of NIH/3T3 cells using BOK Rabbit pAb (A16354) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16354 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BOK. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BOK. (Distance between topics and target gene indicate popularity.) BOK

* Data provided by citexs.com, for reference only.

Publishing research using A16354? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order