Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

BNIP3 Rabbit mAb (A19593)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BNIP3 Rabbit mAb (A19593)

Western blot analysis of extracts of various cell lines, using BNIP3 antibody (A19593) at 1:1000 dilution.Hela cells and NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded human liver using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded rat heart using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded rat kidney using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name BNIP3 Rabbit mAb
Catalog No. A19593
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC50531

Background

This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3).
Sequence AFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
Gene ID 664
Swiss prot Q12983
Synonyms NIP3; HABON; BNIP3
Calculated MW 22kDa
Observed MW 22-28kDa/50-55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Hela+Cobalt chloride, NIH/3T3+Cobalt chloride
Cellular location Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein
Customer validation

WB (Mus musculus, Canis lupus familiaris)

IHC (Canis lupus familiaris)

ICC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BNIP3 Rabbit mAb images

ABclonal:Western blot - BNIP3 Rabbit mAb (A19593)}

Western blot - BNIP3 Rabbit mAb (A19593)

Western blot analysis of extracts of various cell lines, using BNIP3 antibody (A19593) at 1:1000 dilution.Hela cells and NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)}

Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded human liver using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)}

Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded rat heart using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BNIP3 Rabbit mAb (A19593)}

Immunohistochemistry - BNIP3 Rabbit mAb (A19593)

Immunohistochemistry analysis of paraffin-embedded rat kidney using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19593 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BNIP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BNIP3. (Distance between topics and target gene indicate popularity.) BNIP3

* Data provided by citexs.com, for reference only.

Publishing research using A19593? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order