Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

BNIP3 Rabbit pAb (A5683)

Reviews (2) Publications (16) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - BNIP3 Rabbit pAb (A5683)

Western blot analysis of extracts of various cell lines, using BNIP3 antibody (A5683) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - BNIP3 Rabbit pAb (A5683)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - BNIP3 Rabbit pAb (A5683)

Immunohistochemistry analysis of paraffin-embedded rat stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for BNIP3 Rabbit pAb(A5683)
Review
ABclonal: review for BNIP3 Rabbit pAb(A5683)

You may also interested in:

Overview

Product name BNIP3 Rabbit pAb
Catalog No. A5683
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3).
Sequence AFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
Gene ID 664
Swiss prot Q12983
Synonyms NIP3; HABON; BNIP3
Calculated MW 22kDa
Observed MW 22-70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, NIH/3T3, Rat heart
Cellular location Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein
Customer validation

WB (Mouse heart, Human Isikawa Homo sapiens, Homo sapiens, Mus musculus, Rattus norvegicus)

IHC (Mus musculus)

IF (Mus musculus, Rattus norvegicus)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BNIP3 Rabbit pAb images

ABclonal:Western blot - BNIP3 Rabbit pAb (A5683)}

Western blot - BNIP3 Rabbit pAb (A5683)

Western blot analysis of extracts of various cell lines, using BNIP3 antibody (A5683) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - BNIP3 Rabbit pAb (A5683)}

Immunohistochemistry - BNIP3 Rabbit pAb (A5683)

Immunohistochemistry analysis of paraffin-embedded mouse stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - BNIP3 Rabbit pAb (A5683)}

Immunohistochemistry - BNIP3 Rabbit pAb (A5683)

Immunohistochemistry analysis of paraffin-embedded rat stomach using BNIP3 Rabbit pAb (A5683) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A5683

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5683 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BNIP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BNIP3. (Distance between topics and target gene indicate popularity.) BNIP3

* Data provided by citexs.com, for reference only.

Publishing research using A5683? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order