Reviews (2)Publications (3) Datasheet
Product name | BNIP3 Rabbit pAb |
---|---|
Catalog No. | A5683 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human BNIP3 (NP_004043.3). |
---|---|
Sequence | MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDD |
Gene ID | 664 |
Swiss prot | Q12983 |
Synonyms | BNIP3; NIP3 |
Calculated MW | 27kDa |
Observed MW | 22-70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | MCF7, NCI-H460, Jurkat, SH-SY5Y, Mouse kidney, Mouse heart, Mouse liver, Rat brain |
Cellular location | Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein |
Customer validation | (Mouse heart, Human Isikawa ) IHC(Mus musculus) WB(Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at [email protected]
Submit your question about A5683 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A5683? Please let us know so that we can cite the reference in this datasheet.