Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Beclin 1 Rabbit pAb (A7353)

Reviews (6) Publications (114) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Beclin 1 Rabbit pAb (A7353)

Western blot analysis of various lysates, using [KO Validated] Beclin 1 Rabbit pAb (A7353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunoprecipitation - Beclin 1 Rabbit pAb (A7353)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg Beclin 1 antibody (A7353). Western blot was performed from the immunoprecipitate using Beclin 1 antibody (A7353) at a dilution of 1:1000.

Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)
Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)
Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)
Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)
Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)
Review
ABclonal: review for Beclin 1 Rabbit pAb(A7353)

You may also interested in:

Overview

Product name Beclin 1 Rabbit pAb
Catalog No. A7353
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
Sequence MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
Gene ID 8678
Swiss prot Q14457
Synonyms ATG6; VPS30; beclin1; Beclin 1
Calculated MW 52kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples Mouse brain, C6
Cellular location Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane
Customer validation

WB (C2C12, A549,Mouse kidney, U2OS,Saos-2, Human Isikawa , NPCsMus musculus, Sus scrofa, Mus musculus, Rattus norvegicus, Homo sapiens, Gallus gallus, Spodoptera frugiperda, Anatinae, Juvenile tilapia, Pollen, Horabagrus nigricollaris, Mus musculus;Homo sapiens)

IHC (A549,Mouse kidneyMus musculus, Mus musculus, Rattus norvegicus, Homo sapiens)

IF (Sus scrofa, Mus musculus, Rattus norvegicus, Pollen, Homo sapiens)

IP (Nicotiana tabacum)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Beclin 1 Rabbit pAb images

ABclonal:Western blot - Beclin 1 Rabbit pAb (A7353)}

Western blot - Beclin 1 Rabbit pAb (A7353)

Western blot analysis of various lysates, using [KO Validated] Beclin 1 Rabbit pAb (A7353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunoprecipitation - Beclin 1 Rabbit pAb (A7353)}

Immunoprecipitation - Beclin 1 Rabbit pAb (A7353)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg Beclin 1 antibody (A7353). Western blot was performed from the immunoprecipitate using Beclin 1 antibody (A7353) at a dilution of 1:1000.

Submit an review for A7353

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7353 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BECN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BECN1. (Distance between topics and target gene indicate popularity.) BECN1

* Data provided by citexs.com, for reference only.

Publishing research using A7353? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order