Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

BDNF Rabbit mAb (A4873)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - BDNF Rabbit mAb (A4873)

Confocal imaging of paraffin-embedded Rat brain using BDNF Rabbit mAb (A4873, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - BDNF Rabbit mAb (A4873)

Confocal imaging of paraffin-embedded Mouse brain using BDNF Rabbit mAb (A4873, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name BDNF Rabbit mAb
Catalog No. A4873
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0303

Background

This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BDNF (P23560).
Sequence VPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGID
Gene ID 627
Swiss prot P23560
Synonyms ANON2; BULN2; BDNF
Calculated MW 28kDa
Observed MW 15kDa/28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC Mouse
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Secreted
Customer validation

WB (Rattus norvegicus, Mus musculus)

IHC (Homo sapiens)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

BDNF Rabbit mAb images

ABclonal:Immunofluorescence - BDNF Rabbit mAb (A4873)}

Immunofluorescence - BDNF Rabbit mAb (A4873)

Confocal imaging of paraffin-embedded Rat brain using BDNF Rabbit mAb (A4873, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - BDNF Rabbit mAb (A4873)}

Immunofluorescence - BDNF Rabbit mAb (A4873)

Confocal imaging of paraffin-embedded Mouse brain using BDNF Rabbit mAb (A4873, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A4873 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BDNF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BDNF. (Distance between topics and target gene indicate popularity.) BDNF

* Data provided by citexs.com, for reference only.

Publishing research using A4873? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order