Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Bcl-2 Rabbit pAb (A0208)

Reviews (4) Publications (344) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Bcl-2 Rabbit pAb (A0208)

Western blot analysis of lysates from 293T cells, using Bcl-2 Rabbit pAb (A0208) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Bcl-2 Rabbit pAb (A0208)

Immunohistochemistry analysis of Bcl-2 in paraffin-embedded human appendix using Bcl-2 Rabbit pAb (A0208) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Bcl-2 Rabbit pAb (A0208)

Immunofluorescence analysis of NIH/3T3 cells using Bcl-2 Rabbit pAb (A0208) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Bcl-2 Rabbit pAb (A0208)

Immunoprecipitation analysis of 200 μg extracts of THP-1 cells using 3 μg Bcl-2 antibody (A0208). Western blot was performed from the immunoprecipitate using Bcl-2 antibody (A0208) at a dilution of 1:1000.

Review
ABclonal: review for Bcl-2 Rabbit pAb(A0208)
Review
ABclonal: review for Bcl-2 Rabbit pAb(A0208)
Review
ABclonal: review for Bcl-2 Rabbit pAb(A0208)
Review
ABclonal: review for Bcl-2 Rabbit pAb(A0208)

You may also interested in:

Overview

Product name Bcl-2 Rabbit pAb
Catalog No. A0208
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (NP_000624.2).
Sequence MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
Gene ID 596
Swiss prot P10415
Synonyms Bcl-2; PPP1R50
Calculated MW 26kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T
Cellular location Endoplasmic reticulum membrane, Mitochondrion outer membrane, Nucleus membrane, Single-pass membrane protein
Customer validation

WB (rat cells, HCT116, B6, MCF-7,MD-MBA-231Rattus norvegicus, Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus, Bos taurus, Sus scrofa, Giardia duodenalis, Capra hircus, Ctenopharyngodon, Ctenopharyngodon idellus, lamprey, quails, Apocynum venetum leaf, hsa, Cyprinus Carpio, Eriocheir sinensis)

IHC (Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus, Oreochromis niloticus)

IF (Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus)

RT-PCR (Homo sapiens)

Cellular Uptake and In Vitro Fibrotic Marker Visual-ization (Mus musculus)

IP (Rattus norvegicus, Mus musculus, Homo sapiens)

ICH (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Bcl-2 Rabbit pAb images

ABclonal:Western blot - Bcl-2 Rabbit pAb (A0208)}

Western blot - Bcl-2 Rabbit pAb (A0208)

Western blot analysis of lysates from 293T cells, using Bcl-2 Rabbit pAb (A0208) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Bcl-2 Rabbit pAb (A0208)}

Immunohistochemistry - Bcl-2 Rabbit pAb (A0208)

Immunohistochemistry analysis of Bcl-2 in paraffin-embedded human appendix using Bcl-2 Rabbit pAb (A0208) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Bcl-2 Rabbit pAb (A0208)}

Immunofluorescence - Bcl-2 Rabbit pAb (A0208)

Immunofluorescence analysis of NIH/3T3 cells using Bcl-2 Rabbit pAb (A0208) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Bcl-2 Rabbit pAb (A0208)}

Immunoprecipitation - Bcl-2 Rabbit pAb (A0208)

Immunoprecipitation analysis of 200 μg extracts of THP-1 cells using 3 μg Bcl-2 antibody (A0208). Western blot was performed from the immunoprecipitate using Bcl-2 antibody (A0208) at a dilution of 1:1000.

Submit an review for A0208

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0208 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BCL2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BCL2. (Distance between topics and target gene indicate popularity.) BCL2

* Data provided by citexs.com, for reference only.

Publishing research using A0208? Please let us know so that we can cite the reference in this datasheet.

Antibodies (13)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order