Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Apolipoprotein C3 Rabbit pAb |
---|---|
Catalog No. | A1409 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1). |
---|---|
Sequence | MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
Gene ID | 345 |
Swiss prot | P02656 |
Synonyms | Apo-C3; ApoC-3; APOCIII; Apolipoprotein C3 |
Calculated MW | 11kDa |
Observed MW | 11kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HepG2, HL-60, Mouse liver, Mouse small intestine, Rat liver, Rat small intestine |
Cellular location | Secreted |
Customer validation | WB (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A1409 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on APOC3. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to APOC3. (Distance between topics and target gene indicate popularity.) APOC3
* Data provided by citexs.com, for reference only.
Publishing research using A1409? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.