Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Apolipoprotein C3 Rabbit pAb (A1409)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Apolipoprotein C3 Rabbit pAb (A1409)

Western blot analysis of various lysates using Apolipoprotein C3 Rabbit pAb (A1409) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded rat spleen using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded human liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded mouse spleen using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of HepG2 cells using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of paraffin-embedded mouse liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of paraffin-embedded rat liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Apolipoprotein C3 Rabbit pAb
Catalog No. A1409
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins (HDL) and chylomicrons. The encoded protein plays a role in role in the metabolism of these TRLs through multiple modes. This protein has been shown to promote the secretion of VLDL1, inhibit lipoprotein lipase enzyme activity, and delay catabolism of TRL remnants. Mutations in this gene are associated with low plasma triglyceride levels and reduced risk of ischemic cardiovascular disease, and hyperalphalipoproteinemia, which is characterized by elevated levels of high density lipoprotein (HDL) and HDL cholesterol in human patients. This gene and other related genes comprise an apolipoprotein gene cluster on chromosome 11.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-99 of human Apolipoprotein C3 (NP_000031.1).
Sequence MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Gene ID 345
Swiss prot P02656
Synonyms Apo-C3; ApoC-3; APOCIII; Apolipoprotein C3
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HepG2, HL-60, Mouse liver, Mouse small intestine, Rat liver, Rat small intestine
Cellular location Secreted
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Apolipoprotein C3 Rabbit pAb images

ABclonal:Western blot - Apolipoprotein C3 Rabbit pAb (A1409)}

Western blot - Apolipoprotein C3 Rabbit pAb (A1409)

Western blot analysis of various lysates using Apolipoprotein C3 Rabbit pAb (A1409) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded rat spleen using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded human liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunohistochemistry - Apolipoprotein C3 Rabbit pAb (A1409)

Immunohistochemistry analysis of Apolipoprotein C3 in paraffin-embedded mouse spleen using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of HepG2 cells using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of paraffin-embedded mouse liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)}

Immunofluorescence - Apolipoprotein C3 Rabbit pAb (A1409)

Immunofluorescence analysis of paraffin-embedded rat liver using Apolipoprotein C3 Rabbit pAb (A1409) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1409 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on APOC3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to APOC3. (Distance between topics and target gene indicate popularity.) APOC3

* Data provided by citexs.com, for reference only.

Publishing research using A1409? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order