Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ApoB Rabbit mAb (A4184)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - ApoB Rabbit mAb (A4184)

Western blot analysis of extracts of various cell lines, using ApoB Rabbit mAb (A4184) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

You may also interested in:

Overview

Product name ApoB Rabbit mAb
Catalog No. A4184
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0920

Background

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins (LDL), and is the ligand for the LDL receptor. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ApoB (P04114).
Sequence RKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP
Gene ID 338
Swiss prot P04114
Synonyms FLDB; FCHL2; LDLCQ4; apoB-48; apoB-100; ApoB
Calculated MW 516kDa
Observed MW 270kDa/520kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB Rat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse plasma, Rat plasma
Cellular location Cytoplasm, Secreted
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ApoB Rabbit mAb images

ABclonal:Western blot - ApoB Rabbit mAb (A4184)}

Western blot - ApoB Rabbit mAb (A4184)

Western blot analysis of extracts of various cell lines, using ApoB Rabbit mAb (A4184) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

Inquire About This Product

Submit your question about A4184 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on APOB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to APOB. (Distance between topics and target gene indicate popularity.) APOB

* Data provided by citexs.com, for reference only.

Publishing research using A4184? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order