Reviews (2) Publication (1) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Alpha-tubulin (ubiquitous) chain Rabbit mAb |
---|---|
Catalog No. | AC039 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0226 |
Immunogen | Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2). |
---|---|
Sequence | MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT |
Gene ID | 10376 |
Swiss prot | P68363 |
Synonyms | K-ALPHA-1; Alpha-tubulin (ubiquitous) chain |
Calculated MW | 50kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, PC-12, A-549, NIH/3T3, U-251MG, Mouse brain, Rat brain |
Cellular location | cytoplasm, cytoplasmic microtubule, microtubule cytoskeleton |
Customer validation |
WB (Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about AC039 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TUBA1B. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TUBA1B. (Distance between topics and target gene indicate popularity.) TUBA1B
* Data provided by citexs.com, for reference only.
Publishing research using AC039? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives