Product Type > Antibodies > Tag and Loading Control Antibodies

Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039)

Reviews (2) Publication (1) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039)

Western blot analysis of various lysates using Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review
ABclonal: review for Alpha-tubulin (ubiquitous) chain Rabbit mAb(AC039)
Review
ABclonal: review for Alpha-tubulin (ubiquitous) chain Rabbit mAb(AC039)

You may also interested in:

Overview

Product name Alpha-tubulin (ubiquitous) chain Rabbit mAb
Catalog No. AC039
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0226

Background

Enables double-stranded RNA binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in microtubule cytoskeleton organization and mitotic cell cycle. Predicted to act upstream of or within cellular response to interleukin-4. Located in microtubule.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human Alpha-tubulin (ubiquitous) chain (NP_006073.2).
Sequence MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT
Gene ID 10376
Swiss prot P68363
Synonyms K-ALPHA-1; Alpha-tubulin (ubiquitous) chain
Calculated MW 50kDa
Observed MW 52kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, PC-12, A-549, NIH/3T3, U-251MG, Mouse brain, Rat brain
Cellular location cytoplasm, cytoplasmic microtubule, microtubule cytoskeleton
Customer validation

WB (Homo sapiens)

Research Area

Alpha-tubulin (ubiquitous) chain Rabbit mAb images

ABclonal:Western blot - Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039)}

Western blot - Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039)

Western blot analysis of various lysates using Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Submit an review for AC039

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about AC039 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TUBA1B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TUBA1B. (Distance between topics and target gene indicate popularity.) TUBA1B

* Data provided by citexs.com, for reference only.

Publishing research using AC039? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order