Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Albumin Rabbit pAb (A15638)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Albumin Rabbit pAb (A15638)

Western blot analysis of lysates from Mouse brain using Albumin Rabbit pAb(A15638) at 1:600 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:10s.

ABclonal:Immunofluorescence - Albumin Rabbit pAb (A15638)

Immunofluorescence analysis of HepG2 cells using Albumin Rabbit pAb (A15638) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Albumin Rabbit pAb
Catalog No. A15638
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the most abundant protein in human blood. This protein functions in the regulation of blood plasma colloid osmotic pressure and acts as a carrier protein for a wide range of endogenous molecules including hormones, fatty acids, and metabolites, as well as exogenous drugs. Additionally, this protein exhibits an esterase-like activity with broad substrate specificity. The encoded preproprotein is proteolytically processed to generate the mature protein. A peptide derived from this protein, EPI-X4, is an endogenous inhibitor of the CXCR4 chemokine receptor.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human Albumin (NP_000468.1).
Sequence GVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRF
Gene ID 213
Swiss prot P02768
Synonyms HSA; FDAHT; PRO0883; PRO0903; PRO1341; Albumin
Calculated MW 69kDa
Observed MW 69kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Albumin Rabbit pAb images

ABclonal:Western blot - Albumin Rabbit pAb (A15638)}

Western blot - Albumin Rabbit pAb (A15638)

Western blot analysis of lysates from Mouse brain using Albumin Rabbit pAb(A15638) at 1:600 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:10s.
ABclonal:Immunofluorescence - Albumin Rabbit pAb (A15638)}

Immunofluorescence - Albumin Rabbit pAb (A15638)

Immunofluorescence analysis of HepG2 cells using Albumin Rabbit pAb (A15638) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15638 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ALB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ALB. (Distance between topics and target gene indicate popularity.) ALB

* Data provided by citexs.com, for reference only.

Publishing research using A15638? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order