Product Type > Antibodies > Primary Antibodies > Acetyl-specific Antibodies

Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Western blot analysis of various lysates using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at 1:1000 dilution.HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded rat brain using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded human appendix using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded mouse kidney using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).NIH-3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).U-2 OS cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Acetyl-Histone H4-K5 Rabbit mAb
Catalog No. A19525
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0002

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.

Immunogen information

Immunogen A synthetic acetylated peptide around K5 of human Histone H4 (P62805).
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID 8359
Swiss prot P62805
Synonyms H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Acetyl-Histone H4-K5
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
IF/ICC HumanMouseRat
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • DB 1:500 - 1:1000
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa TSA, NIH/3T3 TSA, C6 TSA
Cellular location Chromosome, nucleus
Customer validation

WB (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Acetyl-Histone H4-K5 Rabbit mAb images

ABclonal:Western blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Western blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Western blot analysis of various lysates using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at 1:1000 dilution.HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Dot Blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Dot Blot - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded rat brain using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded human appendix using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunohistochemistry - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunohistochemistry analysis of Acetyl-Histone H4-K5 in paraffin-embedded mouse kidney using Acetyl-Histone H4-K5 Rabbit mAb (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).NIH-3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)}

Immunofluorescence - Acetyl-Histone H4-K5 Rabbit mAb (A19525)

Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 Rabbit mAb (A19525).U-2 OS cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A19525 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Histone H4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Histone H4. (Distance between topics and target gene indicate popularity.) Histone H4

* Data provided by citexs.com, for reference only.

Publishing research using A19525? Please let us know so that we can cite the reference in this datasheet.

Antibodies (33)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order