Product Type > Antibodies > Primary Antibodies > Acetyl-specific Antibodies

Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal: - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Acetyl-Histone H4-K5/K8/K12/K16 in representative gene loci (RPL30), as shown in figure.

ABclonal:Western blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Western blot analysis of various lysates, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A20735) at1:20000 dilution.HeLa, C2C12 and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5/K8/K12/K16 antibody (A22099) at 1:7000 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded human breast tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded human thyroid tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse kidney tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse lung tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded rat colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunofluorescence analysis of HeLa treated by TSA and HeLa cells using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb
Catalog No. A22099
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC54033

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen A synthetic acetylated peptide around K5/K8/K12/K16 of human Histone H4.
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID 8359
Swiss prot P62805
Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Acetyl-Histone H4-K5/K8/K12/K16
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
WB HumanMouseRat
IF/ICC Human
IHC-P HumanMouseRat
Recommended dilution
  • DB 1:2000 - 1:8000
  • WB 1:2000 - 1:20000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:100 - 1:500
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Hele TSA, C2C12 TSA, C6 TSA
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb images

ABclonal: - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

- Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) , along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Acetyl-Histone H4-K5/K8/K12/K16 in representative gene loci (RPL30), as shown in figure.
ABclonal:Western blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Western blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Western blot analysis of various lysates, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A20735) at1:20000 dilution.HeLa, C2C12 and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Dot Blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Dot Blot - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5/K8/K12/K16 antibody (A22099) at 1:7000 dilution.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded human breast tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded human thyroid tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse kidney tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded mouse lung tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunohistochemistry - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunohistochemistry analysis of Acetyl-Histone H4-K5/K8/K12/K16 in paraffin-embedded rat colon tissue using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Immunofluorescence - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Immunofluorescence analysis of HeLa treated by TSA and HeLa cells using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)}

Chromatin Immunoprecipitation - Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb (A22099)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb antibody (A22099) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A22099 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Histone H4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Histone H4. (Distance between topics and target gene indicate popularity.) Histone H4

* Data provided by citexs.com, for reference only.

Publishing research using A22099? Please let us know so that we can cite the reference in this datasheet.

Antibodies (33)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order