Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | Acetyl-Histone H4-K5/K8/K12/K16 Rabbit mAb |
---|---|
Catalog No. | A22099 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54033 |
Immunogen | A synthetic acetylated peptide around K5/K8/K12/K16 of human Histone H4. |
---|---|
Sequence | MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG |
Gene ID | 8359 |
Swiss prot | P62805 |
Synonyms | H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Acetyl-Histone H4-K5/K8/K12/K16 |
Calculated MW | 11kDa |
Observed MW | 11kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | Testing results |
WB | |
IF/ICC | |
IHC-P | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Hele TSA, C2C12 TSA, C6 TSA |
Cellular location | Chromosome, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A22099 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on Histone H4. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to Histone H4. (Distance between topics and target gene indicate popularity.) Histone H4
* Data provided by citexs.com, for reference only.
Publishing research using A22099? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.