Product Type > Antibodies > Primary Antibodies > Acetyl-specific Antibodies

Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from HeLa cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from C6 cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from NIH/3T3 cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Dot Blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K18 antibody (A22566) at 1:10000 dilution.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded human colon carcinoma using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded human lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded mouse lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded rat lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Confocal imaging of HeLa cells (treated with TSA) and HeLa cells (untreated) using Acetyl-Histone H3-K18 Rabbit mAb (A22566, dilution 1:1000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K18 antibody (A22566) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name Acetyl-Histone H3-K18 Rabbit mAb
Catalog No. A22566
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC55729

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic acetylated peptide around K18 of human Histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K18
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
IF/ICC Human
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • DB 1:2000 - 1:10000
  • WB 1:2000 - 1:10000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:500 - 1:1000
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa TSA, NIH/3T3 TSA, C6 TSA
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Acetyl-Histone H3-K18 Rabbit mAb images

ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from HeLa cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from C6 cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Western blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Western blot analysis of lysates from NIH/3T3 cells, using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at 1:10000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Dot Blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Dot Blot - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K18 antibody (A22566) at 1:10000 dilution.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded human colon carcinoma using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded human lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded mouse lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Immunohistochemistry - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Immunohistochemistry analysis of Acetyl-Histone H3-K18 in paraffin-embedded rat lung using Acetyl-Histone H3-K18 Rabbit mAb (A22566) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Immunofluorescence - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Confocal imaging of HeLa cells (treated with TSA) and HeLa cells (untreated) using Acetyl-Histone H3-K18 Rabbit mAb (A22566, dilution 1:1000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.
ABclonal:Chromatin Immunoprecipitation - Acetyl-Histone H3-K18 Rabbit mAb (A22566)}

Chromatin Immunoprecipitation - Acetyl-Histone H3-K18 Rabbit mAb (A22566)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K18 antibody (A22566) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A22566 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Histone H3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Histone H3. (Distance between topics and target gene indicate popularity.) Histone H3

* Data provided by citexs.com, for reference only.

Publishing research using A22566? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order