Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ATRIP Rabbit pAb (A7139)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ATRIP Rabbit pAb (A7139)

Western blot analysis of extracts of various cell lines, using ATRIP antibody (A7139) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name ATRIP Rabbit pAb
Catalog No. A7139
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an essential component of the DNA damage checkpoint. The encoded protein binds to single-stranded DNA coated with replication protein A. The protein also interacts with the ataxia telangiectasia and Rad3 related protein kinase, resulting in its accumulation at intranuclear foci induced by DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ATRIP (NP_569055.1).
Sequence MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDLEELDTLASQALSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQYKELKEKMKVMEEEVLIKNGEIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKEFSKKLQSLQSELQFKDAEMNELRTKLQTSERANKLAAPSVSHVSPRKNPSVVIKPEACSPQFGKTSFPTKESFSANMSLP
Gene ID 84126
Swiss prot Q8WXE1
Synonyms ATRIP
Calculated MW 86kDa
Observed MW 86kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, Jurkat, HeLa, Mouse brain, Mouse heart
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Rattus norvegicus)

IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ATRIP Rabbit pAb images

ABclonal:Western blot - ATRIP Rabbit pAb (A7139)}

Western blot - ATRIP Rabbit pAb (A7139)

Western blot analysis of extracts of various cell lines, using ATRIP antibody (A7139) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A7139 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATRIP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATRIP. (Distance between topics and target gene indicate popularity.) ATRIP

* Data provided by citexs.com, for reference only.

Publishing research using A7139? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order