Reviews (2) Publications (5) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | ATP5A1 Rabbit mAb |
---|---|
Catalog No. | A11217 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0549 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705). |
---|---|
Sequence | VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF |
Gene ID | 498 |
Swiss prot | P25705 |
Synonyms | OMR; ORM; ATPM; MOM2; ATP5A; hATP1; ATP5A1; MC5DN4; ATP5AL2; COXPD22; HEL-S-123m |
Calculated MW | 60kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
IHC-P | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, A549, Mouse liver, Mouse heart, Rat brain |
Cellular location | Cell membrane, Extracellular side, Mitochondrion inner membrane, Peripheral membrane protein |
Customer validation | (, 293T, Hela, A549, HepG2, PC-3, HL-60, RPMI-8226, MOLT-4) WB (Homo sapiens, Mus musculus) IHC (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11217 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ATP5F1A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ATP5F1A. (Distance between topics and target gene indicate popularity.) ATP5F1A
* Data provided by citexs.com, for reference only.
Publishing research using A11217? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.