Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ATP5A1 Rabbit mAb (A11217)

Reviews (2) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ATP5A1 Rabbit mAb (A11217)

Western blot analysis of various lysates using ATP5A1 Rabbit mAb (A11217) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human colon carcinoma using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human kidney using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human liver cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human lung squamous carcinoma tissue using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human thyroid cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded rat liver using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (A11217, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A1 Rabbit mAb (A11217, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A1 Rabbit mAb (A11217, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - ATP5A1 Rabbit mAb (A11217)

Immunoprecipitation analysis of 600 μg extracts of Mouse heart using 3 μg ATP5A1 antibody (A11217). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (A11217) at a dilution of 1:1000.

Review
ABclonal: review for ATP5A1 Rabbit mAb(A11217)
Review
ABclonal: review for ATP5A1 Rabbit mAb(A11217)

You may also interested in:

Overview

Product name ATP5A1 Rabbit mAb
Catalog No. A11217
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0549

Background

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705).
Sequence VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Gene ID 498
Swiss prot P25705
Synonyms OMR; ORM; ATPM; MOM2; ATP5A; hATP1; ATP5A1; MC5DN4; ATP5AL2; COXPD22; HEL-S-123m
Calculated MW 60kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, A549, Mouse liver, Mouse heart, Rat brain
Cellular location Cell membrane, Extracellular side, Mitochondrion inner membrane, Peripheral membrane protein
Customer validation

(, 293T, Hela, A549, HepG2, PC-3, HL-60, RPMI-8226, MOLT-4)

WB (Homo sapiens, Mus musculus)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ATP5A1 Rabbit mAb images

ABclonal:Western blot - ATP5A1 Rabbit mAb (A11217)}

Western blot - ATP5A1 Rabbit mAb (A11217)

Western blot analysis of various lysates using ATP5A1 Rabbit mAb (A11217) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human colon carcinoma using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human kidney using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human liver cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human lung squamous carcinoma tissue using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded human thyroid cancer using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)}

Immunohistochemistry - ATP5A1 Rabbit mAb (A11217)

Immunohistochemistry analysis of ATP5A1 in paraffin-embedded rat liver using ATP5A1 Rabbit mAb (A11217) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)}

Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (A11217, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.
ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)}

Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A1 Rabbit mAb (A11217, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - ATP5A1 Rabbit mAb (A11217)}

Immunofluorescence - ATP5A1 Rabbit mAb (A11217)

Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A1 Rabbit mAb (A11217, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunoprecipitation - ATP5A1 Rabbit mAb (A11217)}

Immunoprecipitation - ATP5A1 Rabbit mAb (A11217)

Immunoprecipitation analysis of 600 μg extracts of Mouse heart using 3 μg ATP5A1 antibody (A11217). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (A11217) at a dilution of 1:1000.

Submit an review for A11217

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11217 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATP5F1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATP5F1A. (Distance between topics and target gene indicate popularity.) ATP5F1A

* Data provided by citexs.com, for reference only.

Publishing research using A11217? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order