Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ATM Rabbit pAb (A15645)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Immunofluorescence - ATM Rabbit pAb (A15645)

Immunofluorescence analysis of U2OS cells using ATM antibody (A15645) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ATM Rabbit pAb
Catalog No. A15645
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2320-2566 of ATM (NP_000042.3).
Sequence DASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANA
Gene ID 472
Swiss prot Q13315
Synonyms AT1; ATA; ATC; ATD; ATE; ATDC; TEL1; TELO1; ATM
Calculated MW 351kDa
Observed MW

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Cytoplasmic vesicle, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ATM Rabbit pAb images

ABclonal:Immunofluorescence - ATM Rabbit pAb (A15645)}

Immunofluorescence - ATM Rabbit pAb (A15645)

Immunofluorescence analysis of U2OS cells using ATM antibody (A15645) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15645 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATM. (Distance between topics and target gene indicate popularity.) ATM

* Data provided by citexs.com, for reference only.

Publishing research using A15645? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order