Reviews (7) Publications (19) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | ATG7 Rabbit pAb |
---|---|
Catalog No. | A0691 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_006386.1). |
---|---|
Sequence | LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL |
Gene ID | 10533 |
Swiss prot | O95352 |
Synonyms | GSA7; APG7L; SCAR31; APG7-LIKE; ATG7 |
Calculated MW | 78kDa |
Observed MW | 78kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, Rat testis |
Cellular location | Cytoplasm, Preautophagosomal structure |
Customer validation | IF (Human colon cancer cell, U-87MG cells, Mouse adenocarcinomaMus musculus, Sus scrofa, Mus musculus) WB (Human chronic myeloid leukemia cells, U-87MG cells, Mouse cells, HeLaMus musculus, Mus musculus, Danio rerio, Homo sapiens, Gallus gallus, Sus scrofa, Rattus norvegicus) IP (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0691 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ATG7. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ATG7. (Distance between topics and target gene indicate popularity.) ATG7
* Data provided by citexs.com, for reference only.
Publishing research using A0691? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.