Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ATG7 Rabbit pAb (A0691)

Reviews (7) Publications (19) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human colon carcinoma using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human colon using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded mouse lung using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat ovary using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat spleen using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ATG7 Rabbit pAb (A0691)

Immunofluorescence analysis of A-549 cells using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ATG7 Rabbit pAb (A0691)

Immunofluorescence analysis of NIH/3T3 cells using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)
Review
ABclonal: review for ATG7 Rabbit pAb(A0691)

You may also interested in:

Overview

Product name ATG7 Rabbit pAb
Catalog No. A0691
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_006386.1).
Sequence LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL
Gene ID 10533
Swiss prot O95352
Synonyms GSA7; APG7L; SCAR31; APG7-LIKE; ATG7
Calculated MW 78kDa
Observed MW 78kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples Jurkat, Rat testis
Cellular location Cytoplasm, Preautophagosomal structure
Customer validation

IF (Human colon cancer cell, U-87MG cells, Mouse adenocarcinomaMus musculus, Sus scrofa, Mus musculus)

WB (Human chronic myeloid leukemia cells, U-87MG cells, Mouse cells, HeLaMus musculus, Mus musculus, Danio rerio, Homo sapiens, Gallus gallus, Sus scrofa, Rattus norvegicus)

IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ATG7 Rabbit pAb images

ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)}

Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human colon carcinoma using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)}

Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human colon using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)}

Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded mouse lung using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)}

Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat ovary using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ATG7 Rabbit pAb (A0691)}

Immunohistochemistry - ATG7 Rabbit pAb (A0691)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat spleen using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ATG7 Rabbit pAb (A0691)}

Immunofluorescence - ATG7 Rabbit pAb (A0691)

Immunofluorescence analysis of A-549 cells using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ATG7 Rabbit pAb (A0691)}

Immunofluorescence - ATG7 Rabbit pAb (A0691)

Immunofluorescence analysis of NIH/3T3 cells using ATG7 Rabbit pAb (A0691) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0691

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0691 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATG7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATG7. (Distance between topics and target gene indicate popularity.) ATG7

* Data provided by citexs.com, for reference only.

Publishing research using A0691? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order