Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ATG13 Rabbit pAb (A0690)

Review (1) Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ATG13 Rabbit pAb (A0690)

Western blot analysis of various lysates, using ATG13 antibody (A0690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 25s.

ABclonal:Immunofluorescence - ATG13 Rabbit pAb (A0690)

Immunofluorescence analysis of HeLa cells using ATG13 Rabbit pAb (A0690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ATG13 Rabbit pAb (A0690)

Immunofluorescence analysis of NIH/3T3 cells using ATG13 Rabbit pAb (A0690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for ATG13 Rabbit pAb(A0690)

You may also interested in:

Overview

Product name ATG13 Rabbit pAb
Catalog No. A0690
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 281-480 of human ATG13 (NP_001136145.1).
Sequence ADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
Gene ID 9776
Swiss prot O75143
Synonyms KIAA0652; PARATARG8; ATG13
Calculated MW 57kDa
Observed MW 72kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse brain, Rat brain
Cellular location Cytoplasm, Preautophagosomal structure, cytosol
Customer validation

WB (HeLaBombyx mori, Homo sapiens, Mycobacterium tuberculosis, Pollen)

IF (Pollen)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ATG13 Rabbit pAb images

ABclonal:Western blot - ATG13 Rabbit pAb (A0690)}

Western blot - ATG13 Rabbit pAb (A0690)

Western blot analysis of various lysates, using ATG13 antibody (A0690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 25s.
ABclonal:Immunofluorescence - ATG13 Rabbit pAb (A0690)}

Immunofluorescence - ATG13 Rabbit pAb (A0690)

Immunofluorescence analysis of HeLa cells using ATG13 Rabbit pAb (A0690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ATG13 Rabbit pAb (A0690)}

Immunofluorescence - ATG13 Rabbit pAb (A0690)

Immunofluorescence analysis of NIH/3T3 cells using ATG13 Rabbit pAb (A0690) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A0690

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0690 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATG13. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATG13. (Distance between topics and target gene indicate popularity.) ATG13

* Data provided by citexs.com, for reference only.

Publishing research using A0690? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order