Products > Catalog Antibodies > Monoclonal Antibodies

ATG12 Rabbit mAb (A19610)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ATG12 antibody (A19610) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - ATG12 Rabbit mAb (A19610)

Immunohistochemistry of paraffin-embedded mouse lung using ATG12 Rabbit mAb (A19610) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - ATG12 Rabbit mAb (A19610)

Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug ATG12 antibody (A19610). Western blot was performed from the immunoprecipitate using ATG12 antibody (A19610) at a dilition of 1:500.

Overview

Product name	ATG12 Rabbit mAb
Catalog No.	A19610
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM, Mar 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 61-140 of human Apg12 (O94817).
Sequence	AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Gene ID	9140
Swiss prot	O94817
Synonyms	ATG12; APG12; APG12L; FBR93; HAPG12; Apg12
Calculated MW	22, 55kDa
Observed MW	55KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	PC-3, Mouse brain, Mouse stomach
Cellular location	Cytoplasm, Peripheral membrane protein, Preautophagosomal structure membrane
Customer validation	WB(Rattus norvegicus)