Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ASC/TMS1 Rabbit pAb (A1170)

Reviews (2) Publications (83) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ASC/TMS1 Rabbit pAb (A1170)

Western blot analysis of lysates from Mouse spleen, using ASC/TMS1 Rabbit pAb (A1170) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of A-549 cells using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of paraffin-embedded mouse spleen using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of paraffin-embedded rat spleen using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for ASC/TMS1 Rabbit pAb(A1170)
Review
ABclonal: review for ASC/TMS1 Rabbit pAb(A1170)

You may also interested in:

Overview

Product name ASC/TMS1 Rabbit pAb
Catalog No. A1170
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-195 of human ASC/TMS1 (NP_037390.2).
Sequence LDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Gene ID 29108
Swiss prot Q9ULZ3
Synonyms ASC; TMS; TMS1; CARD5; TMS-1; ASC/TMS1
Calculated MW 22kDa
Observed MW 15-19kDa/20kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse spleen
Cellular location Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus
Customer validation

WB (Rat brainHomo sapiens, Mus musculus, Rattus norvegicus, Homo sapiens)

IHC (Rat brainRattus norvegicus, Mus musculus)

IF (Streptococcus pneumoniae, Homo sapiens)

RT-qPCR (Homo sapiens)

qPCR (Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ASC/TMS1 Rabbit pAb images

ABclonal:Western blot - ASC/TMS1 Rabbit pAb (A1170)}

Western blot - ASC/TMS1 Rabbit pAb (A1170)

Western blot analysis of lysates from Mouse spleen, using ASC/TMS1 Rabbit pAb (A1170) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)}

Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of A-549 cells using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)}

Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of paraffin-embedded mouse spleen using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)}

Immunofluorescence - ASC/TMS1 Rabbit pAb (A1170)

Immunofluorescence analysis of paraffin-embedded rat spleen using ASC/TMS1 Rabbit pAb (A1170) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1170

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1170 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PYCARD. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PYCARD. (Distance between topics and target gene indicate popularity.) PYCARD

* Data provided by citexs.com, for reference only.

Publishing research using A1170? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order