Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

APOL1 Rabbit mAb (A4412)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - APOL1 Rabbit mAb (A4412)

Western blot analysis of various lysates using APOL1 Rabbit mAb (A4412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - APOL1 Rabbit mAb (A4412)

Confocal imaging of Hep G2 cells using APOL1 Rabbit mAb (A4412, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

You may also interested in:

Overview

Product name APOL1 Rabbit mAb
Catalog No. A4412
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1124

Background

This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791).
Sequence RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
Gene ID 8542
Swiss prot O14791
Synonyms APOL; APO-L; FSGS4; APOL-I; APOL1
Calculated MW 44kDa
Observed MW 55kDa

Applications

Reactivity Human
Tested applications Testing results
IF/ICC Human
WB Human
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HepG2, LO2, Human plasma
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APOL1 Rabbit mAb images

ABclonal:Western blot - APOL1 Rabbit mAb (A4412)}

Western blot - APOL1 Rabbit mAb (A4412)

Western blot analysis of various lysates using APOL1 Rabbit mAb (A4412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunofluorescence - APOL1 Rabbit mAb (A4412)}

Immunofluorescence - APOL1 Rabbit mAb (A4412)

Confocal imaging of Hep G2 cells using APOL1 Rabbit mAb (A4412, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Inquire About This Product

Submit your question about A4412 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on APOL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to APOL1. (Distance between topics and target gene indicate popularity.) APOL1

* Data provided by citexs.com, for reference only.

Publishing research using A4412? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order