Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

AMACR Rabbit mAb (A20825)

PathoQIHC Pathology

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - AMACR Rabbit mAb (A20825)

Western blot analysis of various lysates, using AMACR antibody (A20825) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - AMACR Rabbit mAb (A20825)

Immunohistochemistry analysis of paraffin-embedded human kidney using AMACR Rabbit mAb (A20825) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - AMACR Rabbit mAb (A20825)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using AMACR Rabbit mAb (A20825) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name AMACR Rabbit mAb
Catalog No. A20825
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC5118-02

Background

This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4).
Sequence MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR
Gene ID 23600
Swiss prot Q9UHK6
Synonyms RM; RACE; CBAS4; P504S; AMACRD; AMACR
Calculated MW 42kDa
Observed MW 42kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples LNCaP, Mouse liver, Mouse kidney, Rat liver, Rat kidney
Cellular location Mitochondrion, Peroxisome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

AMACR Rabbit mAb images

ABclonal:Western blot - AMACR Rabbit mAb (A20825)}

Western blot - AMACR Rabbit mAb (A20825)

Western blot analysis of various lysates, using AMACR antibody (A20825) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - AMACR Rabbit mAb (A20825)}

Immunohistochemistry - AMACR Rabbit mAb (A20825)

Immunohistochemistry analysis of paraffin-embedded human kidney using AMACR Rabbit mAb (A20825) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - AMACR Rabbit mAb (A20825)}

Immunohistochemistry - AMACR Rabbit mAb (A20825)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using AMACR Rabbit mAb (A20825) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A20825 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AMACR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AMACR. (Distance between topics and target gene indicate popularity.) AMACR

* Data provided by citexs.com, for reference only.

Publishing research using A20825? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order