Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ALDOC Rabbit pAb (A11618)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ALDOC Rabbit pAb (A11618)

Western blot analysis of various lysates using ALDOC Rabbit pAb (A11618) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - ALDOC Rabbit pAb (A11618)

Immunohistochemistry analysis of ALDOC in paraffin-embedded mouse brain using ALDOC Rabbit pAb (A11618) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ALDOC Rabbit pAb (A11618)

Immunofluorescence analysis of C6 cells using ALDOC Rabbit pAb (A11618) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ALDOC Rabbit pAb (A11618)

Immunofluorescence analysis of NIH/3T3 cells using ALDOC Rabbit pAb (A11618) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ALDOC Rabbit pAb
Catalog No. A11618
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1, 6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ALDOC (NP_005156.1).
Sequence MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANV
Gene ID 230
Swiss prot P09972
Synonyms ALDC; ALDOC
Calculated MW 39kDa
Observed MW 39kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-87MG, LO2, Mouse brain, Mouse kidney, Rat brain, Rat spinal cord
Cellular location cytoskeleton, cytosol, extracellular exosome, extracellular region

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ALDOC Rabbit pAb images

ABclonal:Western blot - ALDOC Rabbit pAb (A11618)}

Western blot - ALDOC Rabbit pAb (A11618)

Western blot analysis of various lysates using ALDOC Rabbit pAb (A11618) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - ALDOC Rabbit pAb (A11618)}

Immunohistochemistry - ALDOC Rabbit pAb (A11618)

Immunohistochemistry analysis of ALDOC in paraffin-embedded mouse brain using ALDOC Rabbit pAb (A11618) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ALDOC Rabbit pAb (A11618)}

Immunofluorescence - ALDOC Rabbit pAb (A11618)

Immunofluorescence analysis of C6 cells using ALDOC Rabbit pAb (A11618) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ALDOC Rabbit pAb (A11618)}

Immunofluorescence - ALDOC Rabbit pAb (A11618)

Immunofluorescence analysis of NIH/3T3 cells using ALDOC Rabbit pAb (A11618) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11618 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ALDOC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ALDOC. (Distance between topics and target gene indicate popularity.) ALDOC

* Data provided by citexs.com, for reference only.

Publishing research using A11618? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order