Product name | ALDH1A1 Rabbit pAb |
---|---|
Catalog No. | A1802 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 48-147 of human ALDH1A1 (NP_000680.2). |
---|---|
Sequence | ELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPI |
Gene ID | 216 |
Swiss prot | P00352 |
Synonyms | ALDH1A1; ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1 |
Calculated MW | 54kDa |
Observed MW | 50-55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | A-549, HT-29, K-562, Mouse liver, Mouse lung, Rat lung |
Cellular location | Cytoplasm |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Mus musculus) |
Submit your question about A1802 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1802? Please let us know so that we can cite the reference in this datasheet.