Review (1)Publications (29) Datasheet
Western blot analysis of extracts of MCF7 cells, using AKT1 antibody (A11016) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded human mammary cancer using AKT1 antibody (A11016) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human uterine cancer using AKT1 antibody (A11016) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human tonsil using AKT1 antibody (A11016) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human lung cancer using AKT1 antibody (A11016) at dilution of 1:100 (40x lens).
Immunofluorescence analysis of L929 cells using AKT1 antibody (A11016) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | AKT1 Rabbit pAb |
|---|---|
| Catalog No. | A11016 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human AKT1 (NP_005154.2). |
|---|---|
| Sequence | KEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA |
| Gene ID | 207 |
| Swiss prot | P31749 |
| Synonyms | AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA; AKT1 |
| Calculated MW | 48kDa/55kDa |
| Observed MW | 60KDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100 IP 1:50 - 1:200 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | MCF7 |
| Cellular location | Cell membrane, Cytoplasm, Nucleus |
| Customer validation | (rat cells) IHC(Rattus norvegicus) WB(Rattus norvegicus, Homo sapiens, Mus musculus, Cyprinus carpio, Dendrobium officinale Kimura et Migo, Capra hircus, Gallus gallus, Ctenopharyngodon idellus) IF(Rattus norvegicus) Co-IP(Homo sapiens) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11016 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A11016? Please let us know so that we can cite the reference in this datasheet.
