Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

AKR7A3 Rabbit pAb (A8194)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - AKR7A3 Rabbit pAb (A8194)

Western blot analysis of extracts of various cell lines, using AKR7A3 antibody (A8194) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name AKR7A3 Rabbit pAb
Catalog No. A8194
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human AKR7A3 (NP_036199.2).
Sequence MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR
Gene ID 22977
Swiss prot O95154
Synonyms AFAR2; AKR7A3
Calculated MW 37kDa
Observed MW 37kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, HT-29, Mouse kidney, Mouse liver, Mouse pancreas
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

AKR7A3 Rabbit pAb images

ABclonal:Western blot - AKR7A3 Rabbit pAb (A8194)}

Western blot - AKR7A3 Rabbit pAb (A8194)

Western blot analysis of extracts of various cell lines, using AKR7A3 antibody (A8194) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A8194 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AKR7A3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AKR7A3. (Distance between topics and target gene indicate popularity.) AKR7A3

* Data provided by citexs.com, for reference only.

Publishing research using A8194? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order