Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ADAMTS13 Rabbit pAb (A8482)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ADAMTS13 Rabbit pAb (A8482)

Western blot analysis of extracts of various cell lines, using ADAMTS13 antibody (A8482) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - ADAMTS13 Rabbit pAb (A8482)

Immunofluorescence analysis of NIH-3T3 cells using ADAMTS13 Polyclonal Antibody (A8482) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ADAMTS13 Rabbit pAb
Catalog No. A8482
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-300 of human ADAMTS13 (NP_620594.1).
Sequence LSPGAPLKGRPPSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAPGSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGHPPDAQ
Gene ID 11093
Swiss prot Q76LX8
Synonyms VWFCP; C9orf8; vWF-CP; ADAM-TS13; ADAMTS-13; ADAMTS13
Calculated MW 154kDa
Observed MW 154kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HepG2, LO2, 22Rv1, U-251MG, Mouse liver
Cellular location Secreted
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ADAMTS13 Rabbit pAb images

ABclonal:Western blot - ADAMTS13 Rabbit pAb (A8482)}

Western blot - ADAMTS13 Rabbit pAb (A8482)

Western blot analysis of extracts of various cell lines, using ADAMTS13 antibody (A8482) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunofluorescence - ADAMTS13 Rabbit pAb (A8482)}

Immunofluorescence - ADAMTS13 Rabbit pAb (A8482)

Immunofluorescence analysis of NIH-3T3 cells using ADAMTS13 Polyclonal Antibody (A8482) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8482 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ADAMTS13. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ADAMTS13. (Distance between topics and target gene indicate popularity.) ADAMTS13

* Data provided by citexs.com, for reference only.

Publishing research using A8482? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order