Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ADAM9 Rabbit pAb (A5388)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ADAM9 Rabbit pAb (A5388)

Western blot analysis of various lysates using ADAM9 Rabbit pAb (A5388) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - ADAM9 Rabbit pAb (A5388)

Immunofluorescence analysis of NIH/3T3 cells using ADAM9 Rabbit pAb (A5388) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ADAM9 Rabbit pAb (A5388)

Immunofluorescence analysis of PC-12 cells using ADAM9 Rabbit pAb (A5388) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ADAM9 Rabbit pAb
Catalog No. A5388
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-210 of human ADAM9 (NP_003807.1).
Sequence AARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ
Gene ID 8754
Swiss prot Q13443
Synonyms MCMP; MDC9; CORD9; Mltng; ADAM9
Calculated MW 91kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples BxPC-3, Mouse liver, Mouse brain
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ADAM9 Rabbit pAb images

ABclonal:Western blot - ADAM9 Rabbit pAb (A5388)}

Western blot - ADAM9 Rabbit pAb (A5388)

Western blot analysis of various lysates using ADAM9 Rabbit pAb (A5388) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - ADAM9 Rabbit pAb (A5388)}

Immunofluorescence - ADAM9 Rabbit pAb (A5388)

Immunofluorescence analysis of NIH/3T3 cells using ADAM9 Rabbit pAb (A5388) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ADAM9 Rabbit pAb (A5388)}

Immunofluorescence - ADAM9 Rabbit pAb (A5388)

Immunofluorescence analysis of PC-12 cells using ADAM9 Rabbit pAb (A5388) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5388 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ADAM9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ADAM9. (Distance between topics and target gene indicate popularity.) ADAM9

* Data provided by citexs.com, for reference only.

Publishing research using A5388? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order