Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ADAM15 Rabbit mAb (A6813)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ADAM15 Rabbit mAb (A6813)

Western blot analysis of extracts of HCT116 cells, using ADAM15 Rabbit mAb (A6813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human colon carcinoma tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human liver tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human small intestine tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded mouse intestin tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded rat lung tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Immunofluorescence analysis of rat rectum using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Confocal imaging of paraffin-embedded Human colon cancer using ADAM15 Rabbit mAb (A6813, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Confocal imaging of paraffin-embedded mouse large intestine using ADAM15 Rabbit mAb (A6813, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name ADAM15 Rabbit mAb
Catalog No. A6813
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1419

Background

The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ADAM15 (Q13444).
Sequence RHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
Gene ID 8751
Swiss prot Q13444
Synonyms MDC15; ADAM15
Calculated MW 55kDa/88kDa/89kDa/90kDa/93kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouseRat
IHC-P HumanRat
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HCT 116
Cellular location Cell junction, Cell projection, Cytoplasmic vesicle, Endomembrane system, acrosome, adherens junction, cilium, flagellum, secretory vesicle
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ADAM15 Rabbit mAb images

ABclonal:Western blot - ADAM15 Rabbit mAb (A6813)}

Western blot - ADAM15 Rabbit mAb (A6813)

Western blot analysis of extracts of HCT116 cells, using ADAM15 Rabbit mAb (A6813) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)}

Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human colon carcinoma tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)}

Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human liver tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)}

Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded human small intestine tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)}

Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded mouse intestin tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - ADAM15 Rabbit mAb (A6813)}

Immunohistochemistry - ADAM15 Rabbit mAb (A6813)

Immunohistochemistry analysis of ADAM15 in paraffin-embedded rat lung tissue using ADAM15 Rabbit mAb (A6813) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)}

Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Immunofluorescence analysis of rat rectum using ADAM15 Rabbit mAb (A6813) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)}

Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Confocal imaging of paraffin-embedded Human colon cancer using ADAM15 Rabbit mAb (A6813, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - ADAM15 Rabbit mAb (A6813)}

Immunofluorescence - ADAM15 Rabbit mAb (A6813)

Confocal imaging of paraffin-embedded mouse large intestine using ADAM15 Rabbit mAb (A6813, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A6813 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ADAM15. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ADAM15. (Distance between topics and target gene indicate popularity.) ADAM15

* Data provided by citexs.com, for reference only.

Publishing research using A6813? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order