Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ACTN2 Rabbit mAb (A8939)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ACTN2 Rabbit mAb (A8939)

Western blot analysis of various lysates using ACTN2 Rabbit mAb (A8939) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - ACTN2 Rabbit mAb (A8939)

Confocal imaging of paraffin-embedded Rat heart using ACTN2 Rabbit mAb (A8939, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunofluorescence - ACTN2 Rabbit mAb (A8939)

Confocal imaging of paraffin-embedded Mouse heart using ACTN2 Rabbit mAb (A8939, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

You may also interested in:

Overview

Product name ACTN2 Rabbit mAb
Catalog No. A8939
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1360

Background

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTN2 (P35609).
Sequence MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANV
Gene ID 88
Swiss prot P35609
Synonyms MPD6; CMH23; CMYP8; CMD1AA; MYOCOZ; ACTN2
Calculated MW 104kDa
Observed MW 104kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC MouseRat
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples RD, Mouse lung, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle
Cellular location Cytoplasm, Z line, myofibril, sarcomere
Customer validation

WB (Homo sapiens)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ACTN2 Rabbit mAb images

ABclonal:Western blot - ACTN2 Rabbit mAb (A8939)}

Western blot - ACTN2 Rabbit mAb (A8939)

Western blot analysis of various lysates using ACTN2 Rabbit mAb (A8939) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - ACTN2 Rabbit mAb (A8939)}

Immunofluorescence - ACTN2 Rabbit mAb (A8939)

Confocal imaging of paraffin-embedded Rat heart using ACTN2 Rabbit mAb (A8939, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
ABclonal:Immunofluorescence - ACTN2 Rabbit mAb (A8939)}

Immunofluorescence - ACTN2 Rabbit mAb (A8939)

Confocal imaging of paraffin-embedded Mouse heart using ACTN2 Rabbit mAb (A8939, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

Inquire About This Product

Submit your question about A8939 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACTN2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACTN2. (Distance between topics and target gene indicate popularity.) ACTN2

* Data provided by citexs.com, for reference only.

Publishing research using A8939? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order