Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

You may also interested in:

Overview

Product name ABflo® 647 Rabbit anti-Human CD48 mAb
Catalog No. A21946
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC53039-ABf647

Background

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48(NP_001769.2)
Sequence QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Gene ID 962
Swiss prot P09326
Synonyms BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102
Calculated MW 28kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at 2-8℃. Avoid freeze.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Application key Flow Cytometry    
Positive samples
Cellular location External side of plasma membrane, Extracellular exosome, Plasma membrane

Research Area

ABflo® 647 Rabbit anti-Human CD48 mAb images

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human CD48 mAb (A21946)

Flow cytometry:1X10^6 K-562 cells (negative control, left) and Daudi cells (right) were surface-stained with ABflo® 647 Rabbit anti-Human CD48 mAb(A21946, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Inquire About This Product

Submit your question about A21946 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD48. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD48. (Distance between topics and target gene indicate popularity.) CD48

* Data provided by citexs.com, for reference only.

Publishing research using A21946? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order